<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SGO-53 SGO-53 Mali 2005 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I13V, I15V, K20I, M36V, R41K, D60E, L63V, I64M, H69K, L89M  
>SGO-53| codons 1-99
PQITLWQRPVVTVKVGGQLIEALLDTGADDTVLEEVNLPGKWKPKMIGGIGGFIKVRQYE
QIVMEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        I31M, V35T, E36D, T39I, V60I, D123E, I135V, S162A, K173T, Q174E, D177E, T200A, E203D, Q207A, R211K I37L, D218H
>SGO-53| codons 1-238
PISPIETVPVKLKPGMDGPKVKQWPLTEEKMKALTDLCIEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTENPEIVI
YQYMDDLYVGSDLEIGQHRAKIDELRAHLLKWGFTTPHKKHQKEPPFLWMGYELHPDK

References
Author Title Citation
Derache, A Evolution of genetic diversity and drug resistance mutations in HIV-1 among untreated patients from Mali between 2005 and 2006. J Antimicrob Chemother, 2008