<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SGO-42 SGO-42 Mali 2005 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        S68G, D123E, A158S, S162A, S163T, K173T, Q174A, D177E, T200A, Q207E, R211K  
>SGO-42| codons 1-242
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIFQATMTKILEPFRTANPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, K14R, K20I, M36I, R41K, L63T, H69Q, L89M  
>SGO-42| codons 1-99
PQITLWQRPIVTVRIGGQLIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QITIEICGQKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Derache, A Evolution of genetic diversity and drug resistance mutations in HIV-1 among untreated patients from Mali between 2005 and 2006. J Antimicrob Chemother, 2008