<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SGO-15 SGO-15 Mali 2005 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        I31M, K32N, V35T, E36A, T39K, K43E, S68G, K122D, D123S, I135T, S162A, K173T, Q174K, D177E, I178M, T200A, Q207A, R211K, V245Q, E248K  
>SGO-15| codons 1-256
PISPIETVPVKLKPGMDGPKVKQWPLTEEKMNALTAICKEMEEEGKISKIGPENPYNTPV
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DDSFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPEMVI
YQYMDDLYVGSDLEIGQHRAKIEELRAHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPKKDSWTVND

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T4S, T12E, I13V, K14R, G16E, L19I, K20I, M36I, R41K, L63S, I64V, H69K, K70R, I72T, L89M  
>SGO-15| codons 1-99
PQISLWQRPLVEVRIEGQIIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QISVEICGKRATGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Derache, A Evolution of genetic diversity and drug resistance mutations in HIV-1 among untreated patients from Mali between 2005 and 2006. J Antimicrob Chemother, 2008