<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BKO-1063 BKO-1063 Mali 2005 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I13A, I15V, K20I, M36T, R41K, L63P, H69K, L89I  
>BKO-1063| codons 1-99
PQITLWQRPVVTAKVGGQLIEALLDTGADDTVLEETNLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLVGPTPVNIIGRNILTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
      V179E K20R, V35T, E36D, T39K, K43Q, V60I, K102Q, I135V, I142M, S162A, K166R, K173T, Q174R, D177E, Q207D, R211K  
>BKO-1063| codons 1-243
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTDICKEMEQEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGMRYQYNVLPQGWKGSPAIFQASMTRILEPFRTRNPEIEI
YQYMDDLYVGSDLEIGQHRTKIEELRDHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQP

References
Author Title Citation
Derache, A Evolution of genetic diversity and drug resistance mutations in HIV-1 among untreated patients from Mali between 2005 and 2006. J Antimicrob Chemother, 2008