<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BKO-1038 BKO-1038 Mali 2005 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, K20I, E35N, M36I, R41K, L63T, E65D, C67S, H69K, I72T, V82I, L89M  
>BKO-1038| codons 1-99
PQITLWQRPIVTVKIGGQLIEALLDTGADDTVLENINLPGKWKPKMIGGIGGFIKVRQYD
QITIDISGKKATGTVLVGPTPINIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K20R, T27S, V35T, E40Q, K43E, V60I, D123E, I135V, S162F, K173I, Q174K, N175Y, I180V, T200E, R211K  
>BKO-1038| codons 1-243
PISPIETVPVKLKPGMDGPRVKQWPLSEEKIKALTEICTQMEEEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQFSMTKILEPFRIKYPDIVV
YQYMDDLYVGSDLEIGQHREKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQP

References
Author Title Citation
Derache, A Evolution of genetic diversity and drug resistance mutations in HIV-1 among untreated patients from Mali between 2005 and 2006. J Antimicrob Chemother, 2008