<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BKO-987 BKO-987 Mali 2005 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, G17E, K20I, M36I, N37D, R41K, H69K, K70R, L89M  
>BKO-987| codons 1-99
PQITLWQRPLVTVRIGEQLIEALLDTGADDTVLEEIDLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6N, K11T, K43E, K46R, K102Q, D121H, K122E, D123S, I142V, S162Y, F171Y, K173A, Q174K, D177E, V179I, T200A  
>BKO-987| codons 1-203
PISPINTVPVTLKPGMDGPKVKQWPLTEEKIKALVEICTEMEEEGRISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQKKSVTVLDVGDAYFSVPL
HESFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQYSMTKILEPYRAKNPEIII
YQYMDDLYVGSDLEIGQHRAKIE

References
Author Title Citation
Derache, A Evolution of genetic diversity and drug resistance mutations in HIV-1 among untreated patients from Mali between 2005 and 2006. J Antimicrob Chemother, 2008