<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BKO-950 BKO-950 Mali 2005 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, K20I, E35Q, M36I, N37D, R41K, R57K, C67E, H69K, V82I, L89M  
>BKO-950| codons 1-99
PQITLWQRPLVTVRIGGQLIEALLDTGADDTVLEQIDLPGKWKPKMIGGIGGFIKVKQYD
QILIEIEGKKAIGTVLVGPTPINIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K11R, V35T, E40D, K49R, V60I, K122E, D123S, K173I, Q174K, T200A, Q207N, R211G  
>BKO-950| codons 1-236
PISPIETVPVRLKPGMDGPKVKQWPLTEEKIKALTEICTDMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELRNHLLGWGFTTPDKKHQKEPPFLWMGYELHP

References
Author Title Citation
Derache, A Evolution of genetic diversity and drug resistance mutations in HIV-1 among untreated patients from Mali between 2005 and 2006. J Antimicrob Chemother, 2008