Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| CA1341 | CA9585 | U.S. | 1999 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | AZT | 52 |
| 2 | AZT+DDI | 100 |
| 3 | AZT+DDC | 40 |
| 4 | D4T | 26 |
| 5 | AZT | 38 |
| 6 | 3TC+AZT+IDV | 72 |
| 7 | 3TC+AZT+DLV+RTV+SQV | 38 |
| 8 | 3TC+ADV+AZT+EFV+NFV+SQV | 53 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| I54V, V82A, L90M | Q58E, G73T | L10I, L19I, R41K, I62V, L63P, A71I, V77I, I93L |
| >CA9585| codons 1-99 PQITLWQRPIVTIKIGGQIKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFVKVREYD QVPIEICGHKIITTVLIGPTPANIIGRNLMTQLGCTLNF |
References
| Author | Title | Citation |
| Shulman, NS | Efavirenz- and adefovir dipivoxil-based salvage therapy in highly treatment-experienced patients: clinical and genotypic predictors of virologic response. | JAIDS, 2000 |
| Wu, TD | Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. | J Virol, 2003 |
| Gonzales, MJ | Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: comparison of isolates from northern California with isolates from other regions. | ARHR, 2003 |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |