<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1341 CA9585 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 52
2 AZT+DDI 100
3 AZT+DDC 40
4 D4T 26
5 AZT 38
6 3TC+AZT+IDV 72
7 3TC+AZT+DLV+RTV+SQV 38
8 3TC+ADV+AZT+EFV+NFV+SQV 53

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M Q58E, G73T L10I, L19I, R41K, I62V, L63P, A71I, V77I, I93L  
>CA9585| codons 1-99
PQITLWQRPIVTIKIGGQIKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFVKVREYD
QVPIEICGHKIITTVLIGPTPANIIGRNLMTQLGCTLNF

References
Author Title Citation
Shulman, NS Efavirenz- and adefovir dipivoxil-based salvage therapy in highly treatment-experienced patients: clinical and genotypic predictors of virologic response. JAIDS, 2000
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005