<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA629 CA9583 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI 52
2 AZT+SQV 313
3 3TC+AZT+IDV 113
4 3TC+D4T+NFV 4
5 AZT+DDI+RTV+SQV 17
6 3TC+D4T+NVP 13
7 3TC+AZT 9
8 3TC+AZT+IDV 17
9 3TC+AZT+EFV+IDV+Unknown 4
10 Unknown 34

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M F53L, G73ST L10I, L63P, C67F, H69HQ, A71V, I72IM, V77I  
>CA9583| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGLIKVRQYD
QIPIEIFGQKVMSTVLIGPTPVNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70R, T215F K219*Q K103N, Y181C, G190A   V35I, T39A, V90VI, K101KR, K122E, I178IL, V179VI, I180V, H208Y, D218E, L228H  
>CA9249| codons 1-236
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICAELEKEGKISKIGPENPYNTPV
FAIKKKNSDRWRKLVDFRELNKRTQDFWEIQLGIPHPAGLRKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDLIV
CQYMDDLYVASDLEIGQHRTKIEELRQYLLRWGFFTPEQKHQKEPPFHWMGYELHP

References
Author Title Citation
Shulman, NS Efavirenz- and adefovir dipivoxil-based salvage therapy in highly treatment-experienced patients: Clinical and genotypic predictors of virologic response. JAIDS, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005