<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1271 CA9580 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 52
2 DDI 52
3 D4T 100
4 3TC+AZT 35
5 3TC+AZT+IDV 22
6 3TC+D4T+IDV 13
7 3TC+D4T+IDV+NVP 4
8 3TC+RTV+SQV 77
9 3TC+DDI+EFV+RTV+SQV+Unknown 27
10 DDI+EFV+Unknown 1
11 None 5
12 3TC+RTV+SQV 10

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, L90M F53FL, L89LV L10I, K20R, E35D, M36I, N37E, R41K, L63P, K70KT, A71AV, G73X, V77I, I93L  
>CA9580| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADDTILEDIELPGKWKPKIVGGIGGLIKVRQYD
QIPIEICGHTVIXTVLIGPTPVNIIGRNVMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y V75L, K219N K103N V108I K20R, T39A, E44D, V118I, K122E, I135T, D177E, H208Y, R211N  
>CA9345| codons 1-262
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICAELEKDGKISKIGPENPYNTPV
FAIKKKNSTKWRKLLDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQYLWNWGFYTPDNKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVG

References
Author Title Citation
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005