<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA634 CA9579 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 157
2 AZT+DDI 157
3 D4T 104
4 AZT+DDC+SQV 13
5 3TC+D4T+IDV 56
6 3TC+NVP 5
7 3TC+AZT+RTV+SQV 37
8 3TC+AZT+EFV+RTV+SQV+Unknown 16
9 3TC+AZT+DDI+EFV+RTV+SQV+Unknown 26
10 3TC+AZT+EFV+IDV+RTV+SQV+Unknown 7

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, G48V, I54T, V82A   L10I, I15IV, K20R, E35D, M36I, N37D, I62V, L63P, A71V, V77I, I93L  
>CA9579| codons 1-99
PQITLWQRPIVTIKVGGQLREALLDTGADDTVLEDIDLPGRWKPKIIVGIGGFTKVRQYD
QVPIEICGHKVIGTVLIGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V, L210W, T215Y   K103N, V106VA A98AG K43E, E44A, W88C, V118I, K122KE, I135V, I142V, D177E, I178M, V189VI, G196E, T200TA, E203D, H208Y, R211DN, H221HY, P243PH P226PS
>CA9353| codons 1-259
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEEAGKISKIGPENPYNTPV
FAIKKKNSDKWRKLVDFRELNKRTQDFCEVQLGIPHPGGLKKNKSATVLDVGDAYFSIPL
DEDFRKYTAFTIPSVNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEMVI
YQYVDDLYIGSDLEIEQHRAKIDELRQYLWDWGFYTPDKKYQKEPSFLWMGYELHPDKWT
VQHIVLPEKDSWTVNDIQK

References
Author Title Citation
Shulman, NS Efavirenz- and adefovir dipivoxil-based salvage therapy in highly treatment-experienced patients: Clinical and genotypic predictors of virologic response. JAIDS, 2000
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005