<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA796 CA9578 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 104
2 AZT+DDI 266
3 3TC+D4T+SQV 39
4 D4T+DDC+NFV 17
5 3TC+AZT+IDV+NVP 17
6 3TC+AZT+IDV 10
7 3TC+AZT+RTV+SQV 28
8 3TC+AZT+EFV+Unknown 27
9 Unknown 15

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M F53FL, G73S L10I, N37D, D60DE, L63P, A71AV, V77I, I93L  
>CA9578| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMDLPGRWKPKIIGGIGGLIKVRQYE
QIPIEICGHKVISTVLIGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70R, M184V, T215F V75M, K219W K103N, Y181C, M230ML V108I K20KR, V35T, V60I, I94IL, K122E, I135T, H208Y, E224ED, L228H, V245E, E248Q N136ND, D218EQ, K220KQ
>CA9349| codons 1-262
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICTELEKEGKISKIGPENPYNTPI
FAIKKKNSDRWRKLMDFRELNKRTQDFWEVQLGLPHPAGLKKNKSVTILDVGDAYFSVPL
DEDFRKYTAFTIPSTDNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYVDDLYVGSDLEIGQHRTKIEELRQYLLRWGFFTPEWQHQKDPPFHWLGYELHPDKWT
VQPIELPQKDSWTVNDIQKLVG

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005