<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA2100 CA9577 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 46
2 DDC 53
3 D4T 91
4 3TC+D4T+IDV 52
5 DLV+AZT+NFV+SQV NA
6 Unknown NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, L90M   K20R, E35D, M36I, Q61E, I62V, L63P, I66F, A71T, I72T  
>CA9577| codons 1-99
PQITLWQRPLVTIKIGGQLREALLDTGADDTILEDINLPGRWKPKMIGGIGGFIKVRQYD
EVPIEFCGHKTTGTVLVGPTPVNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74I, M184V, T215Y D67G, K219KN L100I, M230L V179D V35I, K103R, K122E, I202V, R211K, T240K, V276VI, I329V, Q334E, A371V, K390R, K395R, E399D, A400S, S468P  
>CA9235| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTELEKEGKISKIGPENPYNTPV
FAIKKKGSTKWRKIVDFRELNKRTQDFWEVQLGIPHPAGIKKRKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIDI
YQYVDDLYVGSDLEIGQHRTKVEELRQHLLKWGFYTPDNKHQKEPPFLWLGYELHPDKWK
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKIKQLCKLLRGTKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEVQKQGEGQWTYQIYQEPFKNLKTGKYARMRGA
HTNDVKQLTEVVQKIATESIVIWGKTPKFRLPIQRETWDSWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTDRGRQKVVPLTDTTNQKTELQ
AIHLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVSQIIEQLIKKEKVYLAWVPAHK
GIGGNEQVDKLVSAGIRKVL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005