<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA3994 CA9572 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI 52

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   L10I, I13V, L19I, K20MR, E35ED, M36ML, N37S, L63P, A71T  
>CA9572| codons 1-99
PQITLWQRPIVTVKIGGQIMEALLDTGADDTVLEDLSLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKTIGTVLVGPTPVNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, T215F K219DE K103N, V106VA, Y181YC   P4S, V60I, T69N, R83K, K102R, I135T, S162A, L193LF, G196GV, T200A, I202V, E203ED, D237DA, P243PHQ R199RS, P226PS, L234LH
>CA9246| codons 1-255
PISSIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPI
FAIKKKNSNRWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKRNKSATVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRKQNPDIVI
CQYMDDLYVGSDFEIVQHSAKVDELRQHLLRWGFFTPDEKHQKEPSFLWMGYEHHPAKWT
VQQIVLPEKDSWTVN

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001