<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA3987 CA9567 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI 81
2 D4T 40
3 D4T+SQV 15
4 D4T+IDV 34
5 3TC+AZT+IDV 9
6 3TC+AZT+RTV 13
7 3TC+AZT+NFV 14
8 AZT+D4T+NFV+NVP 20
9 AZT+NFV+SQV 51

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, G48V, I54V, L90M   L63P, I64V, T74S, V77I, I93L  
>CA9567| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKLIVGIGGFVKVRQYD
QIPVEICGHKAIGSVLIGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T215Y       V60I, K102R, V118I, K122E, I135T, I142V, I178M  
>CA9237| codons 1-262
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPI
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKRKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVG

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005