<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4073 CA9565 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI 26
2 3TC+AZT 30
3 3TC+D4T+IDV 17
4 3TC+D4T+NFV 91
5 DDI+RTV+SQV 15

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, I84V, L90M   L10I, L19I, K20KR, E35D, M36I, R57K, L63P, A71IV  
>CA9565| codons 10-99
IVTIKIGGQIREALLDTGADDTVLEDINLPGRWKPKMIGGIGGFVKVKQYDQIPIEICGH
KIIGTVLVGPTPANVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y       R83RK, K104R, K122E, K166R, K173Q, R211K, V245K  
>CA9350| codons 1-248
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKRSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRQQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPE

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005