<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA3983 CA9562 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC 83
2 D4T 39
3 D4T+SQV 13
4 3TC+D4T+IDV 65
5 3TC+D4T+NFV 80

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30DN, L90M N88D R41K, K43R, K45R, L63P, A71V, I72V, V77I, I85IV, Q92K  
>CA9562| codons 11-99
VTIKIGGQLKEALLDTGADNTVLEEMNLPGKWRPRMIGGIGGFIKVRQYDQIPIEICGHK
VVGTVLIGPTPVNIVGRDLMTKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, M184V, T215Y V75M, K219Q     S3SC, V35L, T39A, V60I, K122E, I135T, I167IV, D177DN, I178M, G196E, E203K, Q207E, H208Y, D218DE, K223E, L228H, V245K, E248EV W212LM, L234LV
>CA9232| codons 1-252
PICPIETVPVKLKPGMDGPKVKQWPLTEEKIKALLEICAELEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLMDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKVLEPFRKQNPNMVI
YQYVDDLYVGSDLEIEQHRTKIKELREYLLRLGFYTPEQKHQEEPPFHWMGYEVHPDKWT
VQPIKLPVKDSW

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009