<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA3979 CA9549 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 161
2 3TC+AZT+IDV 13
3 3TC+AZT+SQV 26
4 3TC+AZT+NFV 65
5 3TC+DDI+NVP+RTV+SQV 16

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30DN, L90M N88D K20I, E35D, M36IV, I62V, L63P, H69NT, A71AV  
>CA9549| codons 1-99
PQITLWQRPLVTIKIGGQLIEALLDTGADNTVLEDINLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGNKVIGTVLVGPTPVNIIGRDLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R   K103N, Y181YC   K20R, T69N, R83K, K122E, D123E, D177E, I178M, F214L K219KI
>CA9226| codons 1-219
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSNRWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEMVI
CQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDI

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001