<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA3977 CA9548 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 43
2 AZT+ 3TC 39
3 AZT+ 3TC+ IDV 22
4 D4T+ 3TC+ SQV 23
5 DDI+ 3TC+ RTV 25
6 None 20
7 D4T+ NVP+ NFV 28

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I84V   L10V, I15V, G16E, E34N, E35D, N37S, P39PS, R41K, L63T, I72V, V77I  
>CA9548| codons 1-99
PQITLWQRPVVTIKVEGQLKEALLDTGADDTILNDMSLSGKWKPKIIGGIGGFIKVRQYD
QITIEICGHKAVGTVLIGPTPVNVIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y   K103KN, V106VA, Y181YC A98G K20R, V35I, K43N, E44ED, D123E, E203D, H208Y, R211K, A272P, K277R, I293V, E297R  
>CA9224| codons 1-303
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALIEICTELENDGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKNKSATVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYMDDLYVGSDLEIGQHRTKIDELRQYLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVVPLTREAE
LEL

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: classification, amino acid mutation patterns, and prevalence in a Northern California clinic-based population. J Infect Dis, 2001
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005