Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| CA4004 | CA9543 | U.S. | 1998 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | 3TC+AZT | 73 |
| 2 | 3TC+AZT+IDV | 134 |
| 3 | D4T+DDI+EFV+NFV | 11 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| V32I, V82A | K43T | K20KR, M36I, M46X, I62V, L63P, H69HY, A71V, Q92E |
| >CA9543| codons 1-99 PQITLWQRPLVTIKIGGQLREALLDTGADDTILEEINLPGRWTPKXIGGIGGFIKVRQYD QVPIEICGYKVIGTVLVGPTPANIIGRNLLTEIGCTLNF |
References
| Author | Title | Citation |
| Gonzales, MJ | HIV-1 reverse transcriptase and protease subtypes: classification, amino acid mutation patterns, and prevalence in a Northern California clinic-based population. | J Infect Dis, 2001 |
| Wu, TD | Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. | J Virol, 2003 |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |