<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA798 CA9536 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NRTI 291
2 AZT+DDC+SQV 26
3 None 65
4 3TC+AZT+IDV 105
5 ADV+DDI+EFV 29
6 DDI+EFV 3

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82F, L90M G73C L10I, I15V, G16E, K20I, E35D, M36I, R57K, Q61N, I62V, L63C, C67Y, T74S  
>CA9536| codons 1-99
PQITLWQRPIVTIKVEGQLIEALLDTGADDTVLEDINLPGRWKPKMIGGIGGFIKVKQYD
NVCIEIYGHKAICSVLVGPTPFNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, L210W, T215Y   L100I, K103N   V21I, K43E, K82R, K122E, D177E, T200A, R211K, A272P  
>CA9239| codons 1-272
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIKALVEICTELEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKVVDFRELNRRTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYP

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005