<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA3950 CA9532 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|RTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M G73S, N88NT L10I, K20KM, L63P, H69Y, A71V, V77I, I93L  
>CA9532| codons 1-99
PQITLWQRPIVTIKIGGQLMEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGYKVISTVLIGPTPVNIIGRTLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, L210W, T215Y   Y181C V108I P4PS, T7A, E44D, S68G, A98S, D123E, V179VI, T200TR, Q207E, R211K, H221Y, K277R, T286A  
>CA9176| codons 1-303
PISSIEAVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKDGKISKIGPENPYNTPV
FAIKKKDGTKWRKVVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTILDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
CQYMDDLYVGSDLEIGQHRRKIEELREHLWKWGFYTPDKKYQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGAKALTEVIPLTEEAE
LEL

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005