<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA2256 CA9531 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 29
2 AZT+DDC 78
3 3TC+AZT+SQV 8
4 AZT 17
5 3TC+AZT+RTV 9
6 3TC+AZT 51
7 D4T+IDV 16
8 D4T+IDV+RTV 47

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M   L10I, I15V, K20M, M36I, N37D, L63P, A71V, Q92QK  
>CA9531| codons 1-99
PQITLWQRPIVTIKVGGQLMEALLDTGADDTVLEEIDLPGRWKPKMIGGIGGFVKVRQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLMTKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y       K11R, V35I, K43N, E44ED, R83K, G196E, T200A, Q207E, H208HY, R211K, L228HR, V245E, A272P, K277R, Q278H, T286A, E297R, G333E, R358RK, A360AT, A400L, E404N, N418S, L452A, D460N, H483Y, A554S  
>CA9177| codons 1-560
PISPIETVPVRLKPGMDGPKVKQWPLTEEKIKALIEICTELENDGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIEQHRAKIEELREYLWKWGFYTPDKKHQKEPPFHWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRHLCKLLRGAKALTEVIPLTREAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQEQGQWTYQIYQEPFKNLKTGKYARMKGT
HTNDVKQLTEAVQKIATESIVIWGKTPKFKLPIQKETWELWWTNYWQATWIPEWEFVSTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKAGKAGYVTNRGRQKVVSLTDTTNQKTELQ
AIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVSQIIEQLIKKEKVYLAWVPAHK
GIGGNEQVDKLVSSGIRKVL

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009