<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA22110 CA95213 U.S. 2007 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 122
2 3TC+AZT 213
3 3TC+AZT+IDV 235
4 ATV+DDI+RTV+TDF 175

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y   K103N   K20R, V60VI, V118VI, K122E, D123DG, V179VI, T200A, R211K I270IF
>CA95213| codons 1-299
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSIPL
DEGFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
YQYMDDLYVGSDLEIGQHRAKIEELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQFYAGIKVKQLCKLLRGTKALTEVIPLTEEA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, V82T, I84V L10F, G73GS I15V, R41K, K55R, I62IV, L63P, A71T, I85V, L89LM  
>CA95212| codons 1-99
PQITLWQRPFVTIKVGGQLKEALLDTGADDTVLEEMNLPGKWKPKIIGGIGGFIRVRQYD
QVPIEICGHKTISTVLVGPTPTNVVGRNMLTQIGCTLNF

References
Author Title Citation
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012