<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1485 CA95095 U.S. 2007 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 74
2 D4T+DDC 31
3 3TC+AZT 9
4 3TC+AZT+IDV 31
5 AZT+DDI+IDV 22
6 3TC+DDI+NFV 17
7 None 61
8 D4T+DDI+SQV 22
9 AZT+EFV+SQV 48
10 ABC+AZT+EFV+SQV 165
11 3TC+ABC+TDF 17
12 3TC+ABC+ATV+DDI+RTV+TDF 96
13 3TC+ABC+ATV+RTV+TDF 125

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69DN, K70R, T215F K219Q     K20R, V35M, T39A, E40ED, V60VI, A98S, K104N, I135T, S162Y, G196GE, E203EK, R211Q, L228H, V245E, T286A, V292I, E297K  
>CA95095| codons 1-301
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALMEICADLEKEGKISKIGPENPYNTPI
FAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKNSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIEQHRTKIKELRQHLLQWGFFTPDQKHQKEPPFHWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEIIPLTKEAE
L

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, K14R, L63X, I72V, V77I, I93L  
>CA95094| codons 1-99
PQITLWQRPIVTIRIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIXIEICGHKAVGTVLIGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012