<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
080 BJH_080 Korea 2006 HIV1 B PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I3V, I15V, M36L, L63P, I64V  
>BJH_080| codons 1-99
PQVTLWQRPLVTIKVGGQLKEALLDTGADDTVLEELNLPGRWKPKMIGGIGGFIKVRQYD
QIPVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        A33T, K102R, K122E, T200I, I202V, R211K, V245K, I293V, E312Q, I326V, I329L  
>BJH_080| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKTLVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKRKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRIKVEELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTEEAE
LELAENREILKQPVHGVYYDPSKDLVAELQKQGQG

References
Author Title Citation
Bang, JI Prevalence of primary antiretroviral resistance: Trends in Korea. ARHR, 2008