<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
078 BJH_078 Korea 2006 HIV1 B PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, M36L, N37S, L63T, I72T  
>BJH_078| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEELSLPGRWKPKMIGGIGGFIKVRQYD
QITIEICGHKATGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        A98S, K122E, I135T, I167F, E169ED, N175H, Q197X, T200R, E204D, I329L R211KPQT
>BJH_078| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKFLDPFRKQHPDIVI
YQYMDDLYVGSDLEIGXHRRKIEDLRQHLLTWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAELQKQGQG

References
Author Title Citation
Bang, JI Prevalence of primary antiretroviral resistance: Trends in Korea. ARHR, 2008