<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA3945 CA9495 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 25
2 DDI 21
3 3TC+D4T 13
4 3TC+D4T+IDV 8
5 AZT+DDI+NFV 91
6 RTV+SQV 30
7 EFV+SQV 7

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M G48GW, F53FL L10V, K20R, E35D, M36I, N37E, R57K, L63P, A71V, I93L  
>CA9495| codons 1-99
PQITLWQRPVVTIKIGGQLREALLDTGADDTVLEDIELPGRWKPKMIWGIGGLVKVKQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W T215C Y188L   K43E, K101Q, V118I, D123E, S162C, T200A, R211K, L228H, I270IV, A272P, V292I, E297K  
>CA9165| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLQKKKSVTVLDVGDAYFSIPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLLVGSDLEIGQHRAKIEELRQHLWKWGFCTPDKKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQVYPGIKVKQLCKLLRGTKALTEIIPLTKEAE
LEL

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005