<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
KS98003 KS98003 Kazakhstan 1998 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, E35N, M36I, R41K, H69K, L89M, I93L, C95W V75G
>KS98003| codons 1-99
PQITLWQRPLVTVRIGGQLKEALLDTGADDTVLENINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTGLVGPTPVNIIGRNMLTQLGWTLNF

References
Author Title Citation
Vazquez de Parga, E Analysis of drug resistance-associated mutations in treatment-naive individuals infected with different genetic forms of HIV-1 circulating in countries of the former Soviet Union. J Med Virol, 2005