<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA3940 CA9447 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI|NRTI|PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M   L10I, K20R, E35D, M36I, I62V, L63P, A71V, I85V, I93L  
>CA9447| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADDTVLEDINLPGRWKPKMIGGIGGFVKVRQYD
QVPIEICGHKVIGTVLVGPTPANIVGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Y115F, Q151M, M184V K70S, V75I, F77L, F116Y K103KN, Y181CS   S68G, K122E, D177E, T200TA, Q207E, H221Y  
>CA9154| codons 1-239
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDGTSWRKLIDLRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAFYSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPAIFQSSMTKILEPFRKQNPEIVI
CQYVDDLYVGSDLEIGQHRAKIEELREHLLRWGFTTPDKKYQKEPPFLWMGYELHPDKW

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001