<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA632 CA9435 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 104
2 AZT+DDC 52
3 AZT+DDI 169
4 D4T 56
5 3TC+AZT 35
6 3TC+AZT+IDV 61
7 3TC+AZT+RTV+SQV 58

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V, L210W, T215Y       T39A, K43A, E44D, V118I, K122E, I142V, Q207E, R211K, I293V, E297A  
>CA9435| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEADGKISKIGPENPYNTPV
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELREHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTAEAE
LEL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, G48EV, I54IV, V82T, L90M F53FL L10R, G16A, L63P, A71V, I72IV, T74TS, V77I, I93L  
>CA9441| codons 1-99
PQITLWQRPRVTIKIAGQLKEALLDTGADDTVLEEMNLPGRWKPKLIEGIGGLVKVRQYD
QIPIEICGHKVVGSVLIGPTPTNIIGRNLMTQLGCTLNF

References
Author Title Citation
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Gonzales, MJ Extended spectrum of HIV-1 reverse transcriptase mutations in patients receiving multiple nucleoside analog inhibitors. AIDS, 2003
Shulman, NS Efavirenz- and adefovir dipivoxil-based salvage therapy in highly treatment-experienced patients: clinical and genotypic predictors of virologic response. JAIDS, 2000
Rhee, SY Distribution of human immunodeficiency virus type 1 protease and reverse transcriptase mutation patterns in 4,183 persons undergoing genotypic resistance testing. AAC, 2004
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012