<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BRSQ48 04BRSQ48 Brazil 2004 HIV1 B PBMC None

Treatment History
Order Regimen Weeks
1 3TC+AZT+LPV 35

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14R, G17E, N37S, L63C, V77I, L89F, I93L  
>04BRSQ48| codons 5-99
LWQRPLVTIRIGEQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYDQICI
EICGHKAIGTVLIGPTPVNIIGRNFLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K122E, D123N, I135T, D177E, T200A, F214L L209V
>04BRSQ48| codons 1-227
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELRQHVLRWGLTTPDKKHQKEPPF

References
Author Title Citation
Eyer-Silva, WA Autochthonous horizontal transmission of a CRF02_AG strain revealed by a human immunodeficiency virus type 1 diversity survey in a small city in inner state of Rio de Janeiro, Southeast Brazil. Mem Ins Oswaldo Cruz, 2007