<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BRSQ39 04BRSQ39 Brazil 2004 HIV1 F PBMC None

Treatment History
Order Regimen Weeks
1 AZT|IDV NA
2 3TC+D4T+LPV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, K20R, E35D, M36I, N37D, R41K, R57K, Q61N, L63V, E65D, I72T  
>04BRSQ39| codons 6-99
WQRPLVTIKVGGQLREALLDTGADDTVLEDIDLPGKWKPKMIGGIGGFIKVKQYDNIVID
ICGHKATGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, K49R, I50V, V60I, D121A, K122E, I135V, S162C, E169D, K173A, Q174K, D177E, I178M, T200A, Q207E, R211K  
>04BRSQ39| codons 1-231
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISRVGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
AEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILDPFRAKNPEMVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMG

References
Author Title Citation
Eyer-Silva, WA Autochthonous horizontal transmission of a CRF02_AG strain revealed by a human immunodeficiency virus type 1 diversity survey in a small city in inner state of Rio de Janeiro, Southeast Brazil. Mem Ins Oswaldo Cruz, 2007