<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BRSQ14 05BRSQ14 Brazil 2005 HIV1 B PBMC None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NFV 209

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N L33F, N88D I15V, G17D, E35D, M36V, D60E, I62V, L63P, A71T, I72T  
>05BRSQ14| codons 6-99
WQRPLVTIKVGDQLKEALLDTGADNTVFEDVNLPGRWKPKMIGGIGGFIKVRQYEQVPIE
ICGHKTTGTVLVGPTPVNIIGRDLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y       K122E, D123E, I135T, S162C, D177E, Q207E, R211K  
>05BRSQ14| codons 1-237
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPEIVI
YQYVDDLYVGSDLEIGQHRTKIEELREHLLKWGFYTPDKKHQKEPPFLWMGYELHPD

References
Author Title Citation
Eyer-Silva, WA Autochthonous horizontal transmission of a CRF02_AG strain revealed by a human immunodeficiency virus type 1 diversity survey in a small city in inner state of Rio de Janeiro, Southeast Brazil. Mem Ins Oswaldo Cruz, 2007