<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BRSAP09_PED 05BRSAP09P Brazil 2005 HIV1 F PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, K20R, M36I, N37E, R57K, Q61N, L63A, I72M  
>05BRSAP09P| codons 7-99
QRPVVTIKIGGQLREALLDTGADDTVLEEIELPGRWKPKMIGGIGGFIKVKQYDNIAIEI
CGHKAMGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K22R, V35M, V60I, K64R, D123E, K166R  
>05BRSAP09P| codons 1-231
PISPIETVPVKLKPGMDGPKVRQWPLTEEKIKALMEICTEMEKEGKISKIGPENPYNTPI
FAIRKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLWMG

References
Author Title Citation
Eyer-Silva, WA Autochthonous horizontal transmission of a CRF02_AG strain revealed by a human immunodeficiency virus type 1 diversity survey in a small city in inner state of Rio de Janeiro, Southeast Brazil. Mem Ins Oswaldo Cruz, 2007