<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TX205 03HN_TX205 Honduras 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    G16GE, L63V  
>03HN_TX205| codons 1-99
PQITLWQRPLVTIKIEGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIVIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6ED, E40EA, K43N, K103R, Q174E, F214L, V245I, A272S, T286TA, I293V, L301I, K311Q, E312K  
>03HN_TX205| codons 1-319
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTAMENEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKRKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKENPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIILPEKDSWTVNDIQKLVGKLNWASQIYSGIKVKQLCKLLRGAKALTEVVPLTEEAE
IELAENREILQKPVHGVYY

References
Author Title Citation
Lloyd, B Prevalence of resistance mutations in HIV-1 infected Hondurans at the beginning of the national antiretroviral therapy program. ARHR, 2008