<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TX175 03HN_TX175 Honduras 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L33I T12I, G16E, A22V, M36MIT, P39S, I62V, L63Q, I64V, I72IV  
>03HN_TX175| codons 1-99
PQITLWQRPLVIIKIEGQLKEVLLDTGADDTVIEETNLSGRWKPKMIGGIGGFIKVRQYD
QVQVEICGHKAVGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K20R, S162C, Q174E, V245K, A272P, T286A, I293V, E297A, A304E, E312R G273E
>03HN_TX175| codons 1-325
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKENPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYPEIKVKQLCKLLRGAKALTEVVPLTAEAE
LELEENREILKRPVHGVYYDPSKDL

References
Author Title Citation
Lloyd, B Prevalence of resistance mutations in HIV-1 infected Hondurans at the beginning of the national antiretroviral therapy program. ARHR, 2008