<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TX090 03HN_TX090 Honduras 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35M, K101Q, K103R, D123E, I135K, S162C, Q174E, T200I, L210F, V245M, A272T, T286A, I293V, E297P, E312A Y56YN
>03HN_TX090| codons 1-322
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICTEMEKEGKISKIGPENPNNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLQKRKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSKNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKENPDIVI
YQYMDDLYVGSDLEIGQHRIKIEELRQHLFRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYTGIKVKQLCKLLRGAKALTEVVPLTPEAE
LELAENREILKAPVHGVYYDPS

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12K, L19I, N37D, R41K, I64V, H69Y, I72M  
>03HN_TX090| codons 1-99
PQITLWQRPLVKIKIGGQIKEALLDTGADDTVLEEMDLPGKWKPKMIGGIGGFIKVRQYD
QILVEICGYKAMGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Lloyd, B Prevalence of resistance mutations in HIV-1 infected Hondurans at the beginning of the national antiretroviral therapy program. ARHR, 2008