<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1449 CA9378 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 Unknown 55
2 ABC+ADV+EFV 23
3 ADV+EFV+NFV 21
4 EFV+IDV+NFV 4

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, L210W, T215Y V75I L100I, K103N   K20R, I31L, V35E, T39A, K122E, R211K, A272P, T286A, I293V, T296S, E297A  
>CA9378| codons 1-303
PISPIETVPVKLKPGMDGPRVKQWPLTEEKLKALEEICAELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKVIDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVVPLSAEAE
LEL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N N88D I15V, E35D, M36V, N37E, I62V, L63P  
>CA9793| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADNTVLEDVELPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKAIGTVLVGPTPVNIIGRDLLTQIGCTLNF

References
Author Title Citation
Shulman, NS Efavirenz- and adefovir dipivoxil-based salvage therapy in highly treatment-experienced patients: Clinical and genotypic predictors of virologic response. JAIDS, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005