<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CR075 03HN_CR075 Honduras 2002 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, K20R, E35D, M36I, R41K, I62V, L63S, H69Q, K70R, A71AV, I72IT, L89M  
>03HN_CR075| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QVSIEICGQRVTGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39M, V60I, D123E, T139TA, K173AT, Q174K, I202V, Q207E, R211K, V245Q, I257L, V261I, A272P, K281KR, E291D, V292I, I293V, E297T  
>03HN_CR075| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICMEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNEAPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKNPDIVI
YQYMDDLYVGSDLEIGQHRTKVEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDLQKLIGKLNWASQIYPGIKVKQLCRLLRGTKALTDIVPLTTEAE

References
Author Title Citation
Lloyd, B Prevalence of resistance mutations in HIV-1 infected Hondurans at the beginning of the national antiretroviral therapy program. ARHR, 2008