<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4075 CA9355 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC 65
2 D4T 43
3 D4T+3TC+IDV 112
4 D4T+DDI+NVP 42

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L210W, T215Y       V21I, V35M, K43N, E44D, V106I, V118I, K122E, D123E, I135T, I178M, Q197I, H208Y, R211K  
>CA9355| codons 1-244
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIKALMEICTELENDGKISKIGPENPYNTPV
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSITVLDVGDAYFSIPL
DEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
YQYMDDLYVGSDLEIGIHRTKIEELRQYLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPI

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I L10F, N88T I15V, K20T, M36MI, L63P, A71T  
>CA9597| codons 1-99
PQITLWQRPFVTIKVGGQLTEALLDTGADDTVLEEINLPGRWKPKIIGGIGGFIKVRQYD
QIPIEICGHKTIGTVLVGPTPVNIIGRTLLTQIGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012