<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CR042 03HN_CR042 Honduras 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103N V108I K20R, I135T, S162C, Q174E, Q207R, F214L, H221Y, V245M, K249R, A272S, K277R, Q278E, I293V, E298A, E312K  
>03HN_CR042| codons 1-316
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKENPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRRHLLRWGLTTPDKKYQKEPPFLWMGYELHPDKWT
VQPIMLPERDSWTVNDIQKLVGKLNWASQIYSGIKVRELCKLLRGTKALTEVVPLTEAAE
LELAENREILKKPVHG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   L10I, I13V, K14R, I15V, N37E, L63P, I64V, I72V, V77I, I93L  
>03HN_CR042| codons 1-99
PQITLWQRPIVTVRVGGQLKEALLDTGADDTVLEEMELPGRWKPKMIGGIGGFIKVRQYD
QIPVEICGHKAVGTVLIGPTPVNIIGRNLMTQLGCTLNF

References
Author Title Citation
Lloyd, B Prevalence of resistance mutations in HIV-1 infected Hondurans at the beginning of the national antiretroviral therapy program. ARHR, 2008