<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
NL_KHM_CA39 CA39W52R Cambodia 2005 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 NVP 1
2 None 51

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39N, E40D, K122E, D123S, S162C, K173T, Q174K, D177E, Q207S, R211S, K238R, V245E  
>CA39W52R| codons 16-250
MDGPKVKQWPLTEEKIKALTEICNDMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLV
DFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSI
NNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRTKNPEIVIYQYMDDLYVGSDLEI
GQHRTKIEELRSHLLSWGFTTPDKKHQKEPPFLWMGYELHPDRWTVQPIELPEKD

References
Author Title Citation
Ly, N Reverse transcriptase mutations in Cambodian CRF01_AE isolates after antiretroviral prophylaxis against HIV Type 1 perinatal transmission. ARHR, 2007