<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
NL_KHM_CA53 CA53W6R Cambodia 2005 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 AZT 9
2 AZT+NVP 1
3 None 5

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
  V75VL Y181YC   V21I, V35T, T39K, K43E, K122E, D123S, T165I, Q174K, D177E, I178M, Q207A, R211S, K238R, V245E  
>CA53W6R| codons 16-250
MDGPKIKQWPLTEEKIKALTEICKEMEEEGKISKIGPENPYNTPVFAIKKKDSTKWRKLL
DFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSI
NNETPGIRYQYNVLPQGWKGSPAIFQSSMIKILEPFRKKNPEMVICQYMDDLYVGSDLEI
GQHRTKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDRWTVQPIELPEKD

References
Author Title Citation
Ly, N Reverse transcriptase mutations in Cambodian CRF01_AE isolates after antiretroviral prophylaxis against HIV Type 1 perinatal transmission. ARHR, 2007