<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
NL_KHM_CA60 CA60W2R Cambodia 2005 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 AZT 9
2 AZT+NVP 1
3 None 1

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    Y181YC   V35T, T39N, V106I, K122E, D123S, I135T, S162C, K173AT, Q174K, D177E, I178M, T200I, Q207A, R211S, E224D, K238R, V245E  
>CA60W2R| codons 16-250
MDGPKVKQWPLTEEKIKALTEICNEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLV
DFRELNKRTQDFWEVQLGIPHPAGLKKKKSITVLDVGDAYFSVPLDESFRKYTAFTIPST
NNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRTKNPEMVICQYMDDLYVGSDLEI
GQHRIKIEELRAHLLSWGFTTPDKKHQKDPPFLWMGYELHPDRWTVQPIELPEKD

References
Author Title Citation
Ly, N Reverse transcriptase mutations in Cambodian CRF01_AE isolates after antiretroviral prophylaxis against HIV Type 1 perinatal transmission. ARHR, 2007