<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
KEH169M KEH169M South Africa 2002 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 NVP 1
2 None 12

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        P4S, V35T, E36A, T39E, E40D, S48T, V60I, K122E, D123S, E138A, T165I, K173A, Q174K, D177E, T200A, Q207E, R211K, V245Q, A272P, K277R, T286A, E291D, V292I, I293V, E308K, K311R  
>KEH169M| codons 1-333
PISSIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEDMEKEGKITKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNATPGIRYQYNVLPQGWKGSPAIFQSSMIKILEPFRAKNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVPLTEEAE
LELAENRKILREPVHGVYYDPSKDLIAEIQKQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14R, I15V, L19V, E35D, M36I, R41K, H69K, L89M, I93L  
>KEH169M| codons 1-99
PQITLWQRPLVTIRVGGQVKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Martinson, NA Selection and persistence of viral resistance in HIV-infected children after exposure to single-dose nevirapine. JAIDS, 2007