<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1480 CA9331 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 104
2 3TC+ AZT 24
3 AZT+ 3TC+ IDV 14
4 AZT+ 3TC+ SQV 57
5 DDI+ NVP+ NFV 23
6 D4T+ DDI+ RTV+ SQV 32

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T215Y   Y181C   V21I, K101X, K122KE, I178M, R211K, L228R  
>CA9331| codons 1-250
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLXKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
CQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFYTPDKKHQKEPPFRWMGYELHPDKWT
VQPIVLPEKD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V, L90M F53FL, Q58E, T74P L10I, K20M, E35ED, M36I, R41K, K55R, I62V, L63A, A71V, I93L  
>CA9765| codons 1-99
PQITLWQRPIVTIKIGGQLMEALLDTGADDTVLEDINLPGKWKPKIIGGIGGLIRVREYD
QVAIEICGHKVIGPVLVGPTPVNVIGRNLMTQLGCTLNF

References
Author Title Citation
Gonzales, MJ Extended spectrum of HIV-1 reverse transcriptase mutations in patients receiving multiple nucleoside analog inhibitors. AIDS, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005