<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
NVJ734 NVJ734 Nigeria 2004 HIV1 A PBMC None

Treatment History
Order Regimen Weeks
1 NVP 1
2 None 12

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E28G, V35T, T39A, E40D, K122E, D123T, I135T, I142V, S162A, K173S, Q174K, D177E, V179I, I180V, Q207A, V245Q, E248N, K281R, T286A, E291D, V292I, I293V, P294T, V317A, S322T, I326V, G335D, R356K, M357K, G359S, K366R, T369V, A371V, I375V, A376V, V381I, T386A, T403I, E432D, V435T, G436E  
>NVJ734| codons 1-440
PISPIETVPVKLKPGMDGPKVKQWPLTGEKIKALTEICADMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DETFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQASMTKILEPFRSKNPEIIV
YQYMDDLYVGSDLEIGQHRTKIEELRAHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPNKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCRLLRGAKALTDIVTLTEEAE
LELAENREILKEPVHGAYYDPTKDLVAEIQKQGQDQWTYQIYQEPFKNLKTGKYAKKRSA
HTNDVRQLVEVVQKVVTESIIIWGKAPKFKLPIQKETWEAWWIEYWQATWIPEWEFVNTP
PLVKLWYQLEKDPITEAETF

References
Author Title Citation
Ojesina, AI Characterization of HIV type 1 reverse transcriptase mutations in infants infected by mothers who received peripartum nevirapine prophylaxis in Jos, Nigeria. ARHR, 2007