<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
NVJ441 NVJ441 Nigeria 2004 HIV1 CRF02_AG PBMC None

Treatment History
Order Regimen Weeks
1 NVP 1
2 None 12

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    Y181C   V35T, E36D, K122E, D123N, I135V, S162A, S163G, K173T, Q174K, D177E, T200A, Q207E, R211K, E224G, K238E, V245E, E248D, V276I, T286A, E291D, V292I, I293V, P294T, K311R, S322T, I326V, G335D, R356K, M357K, G359S, A371V, I375V, A376T, K390R, T403M, E432D, V435A  
>NVJ441| codons 1-440
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTDICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQAGMTKILEPFRTKNPEIVI
CQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKGPPFLWMGYELHPDEWT
VQPIELPDKDSWTVNDIQKLVGKLNWASQIYAGIKIKQLCKLLRGAKALTDIVTLTEEAE
LELAENREILREPVHGVYYDPTKDLVAEIQKQGQDQWTYQIYQEPFKNLKTGKYAKKRSA
HTNDVKQLTEVVQKVTTESIVIWGKTPKFRLPIQKETWEAWWMEYWQATWIPEWEFVNTP
PLVKLWYQLEKDPIAGAETF

References
Author Title Citation
Ojesina, AI Characterization of HIV type 1 reverse transcriptase mutations in infants infected by mothers who received peripartum nevirapine prophylaxis in Jos, Nigeria. ARHR, 2007