<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4042 CA9305 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDC 104
2 D4T 104
3 3TC+ AZT+ RTV+ SQV 52
4 3TC+ AZT+ EFV+ RTV+ SQV 52
5 3TC+ D4T+ IDV+ NVP 62

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y   G190S A98AG K20KR, T27S, K43E, K101X, V118I, K122E, S162C, E169D, I178L, M184X, R211K, L228H  
>CA9305| codons 1-234
PISPIETVPVKLKPGMDGPRVKQWPLSEEKIKALVEICTELEEEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPGGLXKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILDPFRKQNPDLVI
YQYXDDLYVSSDLEIGQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFHWMGYEL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, I84V, L90M   E34EQ, N37S, I62V, L63P, V77I, I93L  
>CA9746| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLQEMSLPGRWKPKIIGGIGGFIKVRQYD
QVPIEICGHKAIGTVLIGPTPVNVIGRNLMTQLGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005